Antibodies

Jump to Filters
View as table Download
GBP6 Rabbit Polyclonal Antibody
TA320124

USD 430.00

5 Days

Rabbit Polyclonal GBP6 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen GBP6 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human GBP6.
GBP6 Rabbit Polyclonal Antibody
TA331528

USD 375.00

5 Days

Rabbit Polyclonal Anti-GBP6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GBP6 Antibody is: synthetic peptide directed towards the N-terminal region of Human GBP6. Synthetic peptide located within the following region: MWCVPHPSKPNHTLVLLDTEGLGDVEKGDPKNDSWIFALAVLLCSTFVYN