Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-GCHFR antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GCHFR. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-GCHFR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GCHFR Antibody: synthetic peptide directed towards the N terminal of human GCHFR. Synthetic peptide located within the following region: MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVD |
GCHFR Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GCHFR |
Active filters
Target Symbol
- GCHFR