Mouse Monoclonal GCSAM (HGAL) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal GCSAM (HGAL) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal Anti-GCET2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GCET2 antibody: synthetic peptide directed towards the middle region of human GCET2. Synthetic peptide located within the following region: YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH |