GCSH Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GCSH Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GCSH Antibody
Applications | IHC |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence IGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSP |
GCSH rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GCSH |
GCSH rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GCSH |
GCSH Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human GCSH (NP_004474.2). |
Modifications | Unmodified |