Antibodies

Jump to Filters
View as table Download
BMP9 (GDF2) Rabbit Polyclonal Antibody
TA333780

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-GDF2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-GDF2 Antibody: synthetic peptide directed towards the middle region of human GDF2. Synthetic peptide located within the following region: CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDM
BMP9 (GDF2) Rabbit Polyclonal Antibody
TA350760

USD 345.00

In Stock

Rabbit Polyclonal Anti-GDF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GDF2
GDF2 Rabbit Polyclonal Antibody
TA366843

USD 380.00

4 Weeks

GDF2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GDF2
BMP9 (GDF2) Rabbit Polyclonal Antibody
TA376530

USD 220.00

3 Weeks

GDF2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 320-429 of human GDF2 (NP_057288.1).
Modifications Unmodified