Rabbit Polyclonal Anti-GEM Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GEM antibody: synthetic peptide directed towards the C terminal of human GEM. Synthetic peptide located within the following region: ETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFW |
Rabbit Polyclonal Anti-ZNF791 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF791 antibody: synthetic peptide directed towards the N terminal of human ZNF791. Synthetic peptide located within the following region: ETFKNLASIGEKWEDPNVEDQHKNQGRNLRSHTGERLCEGKEGSQCAENF |
GEM Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse GEM |
GEM Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human GEM (NP_005252.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
