Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-GFI1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GFI1 antibody: synthetic peptide directed towards the N terminal of human GFI1. Synthetic peptide located within the following region: MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAE |
Rabbit Polyclonal Anti-GFI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GFI1 antibody: synthetic peptide directed towards the N terminal of human GFI1. Synthetic peptide located within the following region: VPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPDSCEGSVCE |
Carrier-free (BSA/glycerol-free) GFI1 mouse monoclonal antibody, clone OTI6H7 (formerly 6H7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GFI1 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) GFI1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GFI1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GFI1 |
GFI1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GFI1 (NP_001120687.1). |
GFI1 mouse monoclonal antibody, clone OTI6H7 (formerly 6H7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GFI1 mouse monoclonal antibody, clone OTI6H7 (formerly 6H7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
GFI1 mouse monoclonal antibody, clone OTI6H7 (formerly 6H7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
GFI1 mouse monoclonal antibody, clone OTI6H7 (formerly 6H7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GFI1 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GFI1 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
GFI1 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
GFI1 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GFI1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GFI1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
GFI1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
GFI1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- GFI1