Rabbit Polyclonal Anti-GFPT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GFPT2 antibody: synthetic peptide directed towards the N terminal of human GFPT2. Synthetic peptide located within the following region: DLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQ |
Rabbit Polyclonal Anti-GFPT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GFPT2 antibody: synthetic peptide directed towards the middle region of human GFPT2. Synthetic peptide located within the following region: TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH |
GFPT2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 200-260 of human GFPT2 (NP_005101.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
