Antibodies

View as table Download

Rabbit polyclonal GIT1 antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human GIT1.

Mouse Monoclonal Anti-GIT1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-GIT1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Git1 antibody is: synthetic peptide directed towards the middle region of Rat Git1. Synthetic peptide located within the following region: PLLSSSQEGSRHASKLSRHGSGAESDYENTQSGEPLLGLEGKRFLELSKE

GIT1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GIT1

GIT1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GIT1

GIT1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 460-640 of human GIT1 (NP_054749.2).
Modifications Unmodified