Germany
Japan
United Kingdom
China
Rabbit polyclonal GIT1 antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human GIT1. |
Antibodies
View as table DownloadMouse Monoclonal Anti-GIT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GIT1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Git1 antibody is: synthetic peptide directed towards the middle region of Rat Git1. Synthetic peptide located within the following region: PLLSSSQEGSRHASKLSRHGSGAESDYENTQSGEPLLGLEGKRFLELSKE |
GIT1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GIT1 |
GIT1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GIT1 |
GIT1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 460-640 of human GIT1 (NP_054749.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GIT1