Rabbit Polyclonal Anti-GLP2R Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLP2R antibody: synthetic peptide directed towards the N terminal of human GLP2R. Synthetic peptide located within the following region: KLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRP |
GLP2R rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GLP2R |
GLP2R (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 219-248 amino acids from the Central region of human GLP2R |
Glp-2 / GLP2R Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | GLP2R / Glp-2 antibody was raised against synthetic 16 amino acid peptide from internal region of human GLP2R. Percent identity with other species by BLAST analysis: Human, Monkey, Marmoset (100%); Gorilla, Gibbon (94%); Rat, Dog, Bovine, Elephant, Panda (81%). |
Glp-2 / GLP2R Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla, Gibbon |
| Immunogen | GLP2R / Glp-2 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GLP2R. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset (81%). |
Glp-2 / GLP2R Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GLP2R / Glp-2 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GLP2R. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Marmoset, Hamster (88%); Mouse, Horse (81%). |
Anti-GLP2R Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-179 amino acids of human glucagon-like peptide 2 receptor |
GLP2R rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GLP2R |
GLP2R Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human GLP2R (NP_004237.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
