Antibodies

Jump to Filters
View as table Download
GLYATL2 Rabbit Polyclonal Antibody
TA329583

USD 375.00

5 Days

Rabbit polyclonal anti-GLYATL2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLYATL2 antibody: synthetic peptide directed towards the middle region of human GLYATL2. Synthetic peptide located within the following region: LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK
GLYATL2 Rabbit Polyclonal Antibody
TA366192

USD 380.00

4 Weeks

GLYATL2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GLYATL2
GLYATL2 Rabbit Polyclonal Antibody
TA370545

USD 380.00

4 Weeks

GLYATL2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GLYATL2