Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-Ga15/16 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 356of human G 15 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-GNA15 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNA15 antibody: synthetic peptide directed towards the N terminal of human GNA15. Synthetic peptide located within the following region: ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG |
G protein alpha 16 (GNA15) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 340-369 amino acids from the C-terminal region of human G protein alpha 15 |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) GNA15 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) GNA15 mouse monoclonal antibody,clone OTI1D3
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) GNA15 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
GNA15 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 112-374 of human GNA15 (NP_002059.3). |
USD 379.00
In Stock
GNA15 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GNA15 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3), Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
GNA15 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3), HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
USD 159.00
In Stock
GNA15 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
GNA15 mouse monoclonal antibody,clone OTI1D3
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GNA15 mouse monoclonal antibody,clone OTI1D3, Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
GNA15 mouse monoclonal antibody,clone OTI1D3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
GNA15 mouse monoclonal antibody,clone OTI1D3
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
GNA15 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GNA15 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11), Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
GNA15 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11), HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
GNA15 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- GNA15