Antibodies

View as table Download

Rabbit Polyclonal Anti-GNAQ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAQ antibody: synthetic peptide directed towards the N terminal of human GNAQ. Synthetic peptide located within the following region: DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK

Goat Anti-GNAQ / ALPHA-q (aa162-175) Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence C-NDLDRVADPAYLPT, from the internal region of the protein sequence according to NP_002063.2.

Gnaq Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated

GNAQ Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human GNAQ

GNAQ Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-359 of human GNAQ (NP_002063.2).
Modifications Unmodified

GNAQ Rabbit monoclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated