Rabbit Polyclonal Anti-GNB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNB1 |
Rabbit Polyclonal Anti-GNB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNB1 |
Rabbit Polyclonal Anti-GNB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNB1 antibody: synthetic peptide directed towards the N terminal of human GNB1. Synthetic peptide located within the following region: MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT |
Rabbit Polyclonal Anti-GNB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNB1 antibody: synthetic peptide directed towards the C terminal of human GNB1. Synthetic peptide located within the following region: DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKAD |
GNB1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNB1 |
GNB1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-340 of human GNB1 (NP_002065.1). |
Modifications | Unmodified |