Antibodies

Jump to Filters
View as table Download
GNG4 Rabbit Polyclonal Antibody
TA332094

USD 375.00

5 Days

Rabbit Polyclonal Anti-GNG4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GNG4 Antibody is: synthetic peptide directed towards the middle region of Human GNG4. Synthetic peptide located within the following region: EACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL