Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-PLCH Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLCH Antibody: A synthesized peptide derived from human PLCH |
Rabbit Polyclonal Anti-Agpat9 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Agpat9 antibody is: synthetic peptide directed towards the middle region of Rat Agpat9. Synthetic peptide located within the following region: HGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILI |
Carrier-free (BSA/glycerol-free) AGPAT9 mouse monoclonal antibody,clone OTI1D10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AGPAT9 mouse monoclonal antibody,clone OTI3G3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GPAT3 Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
GPAT3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GPAT3 |
AGPAT9 mouse monoclonal antibody,clone OTI1D10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
AGPAT9 mouse monoclonal antibody,clone OTI1D10, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
AGPAT9 mouse monoclonal antibody,clone OTI1D10, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
AGPAT9 mouse monoclonal antibody,clone OTI1D10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
AGPAT9 mouse monoclonal antibody,clone OTI3G3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
AGPAT9 mouse monoclonal antibody,clone OTI3G3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
AGPAT9 mouse monoclonal antibody,clone OTI3G3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
AGPAT9 mouse monoclonal antibody,clone OTI3G3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- GPAT3