Antibodies

Jump to Filters
View as table Download
GPATCH3 Rabbit Polyclonal Antibody
TA337327

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPATCH3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPATCH3 antibody is: synthetic peptide directed towards the C-terminal region of Human GPATCH3. Synthetic peptide located within the following region: KGIGRKVMERQGWAEGQGLGCRCSGVPEALDSDGQHPRCKRGLGYHGEKL