Germany
Japan
United Kingdom
China
Antibodies
View as table Download
GPC4 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Dog, Gorilla, Hamster, Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Hamster, Panda, Dog, Pig (100%); Marmoset, Mouse, Elephant, Bovine, Horse (94%); Rat, Bat, Rabbit (88%). |
GPC4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Gorilla, Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from internal region of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Bat, Hamster (100%); Marmoset, Dog, Elephant, Panda, Rabbit (94%); Bovine, Horse, Pig (88%). |
GPC4 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset, Rabbit (94%); Mouse, Rat, Bovine, Panda (88%); Hamster, Horse (81%). |
GPC4 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey, Rabbit |
| Immunogen | GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from N-terminus of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Rabbit (100%); Mouse, Rat, Dog, Panda, Platypus (94%); Opossum, Xenopus (88%). |
Rabbit Polyclonal Anti-GPC4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPC4 antibody is: synthetic peptide directed towards the C-terminal region of Human GPC4. Synthetic peptide located within the following region: EYQQCPSEFDYNATDHAGKSANEKADSAGVRPGAQAYLLTVFCILFLVMQ |
GPC4 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GPC4 |
GPC4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 357-556 of human GPC4 (NP_001439.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GPC4