Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPD2 antibody: synthetic peptide directed towards the N terminal of human GPD2. Synthetic peptide located within the following region: DILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR |
Rabbit Polyclonal Anti-GPD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPD2 antibody is: synthetic peptide directed towards the N-terminal region of Human GPD2. Synthetic peptide located within the following region: LSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNHVVDISESGLITI |
Rabbit Polyclonal Anti-GPD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPD2 antibody: synthetic peptide directed towards the middle region of human GPD2. Synthetic peptide located within the following region: GQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGG |
GPD2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GPD2 |
GPD2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-325 of human GPD2 (NP_000399.3). |
| Modifications | Unmodified |
GPD2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-325 of human GPD2 (NP_000399.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GPD2