Germany
Japan
United Kingdom
China
Rabbit Polyclonal Glucose 6 phosphate isomerase Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Antibodies
View as table Download
USD 450.00
2 Weeks
Rabbit Polyclonal Anti-GPI Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPI antibody: synthetic peptide directed towards the C terminal of human GPI. Synthetic peptide located within the following region: SFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ |
Rabbit Polyclonal Anti-GPI Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPI antibody: synthetic peptide directed towards the C terminal of human GPI. Synthetic peptide located within the following region: EALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLT |
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
GPI rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GPI |
glucose-6-phosphate isomerase Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human glucose-6-phosphate isomerase (NP_000166.2). |
| Modifications | Unmodified |
glucose-6-phosphate isomerase Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human glucose-6-phosphate isomerase (NP_000166.2). |
| Modifications | Unmodified |
USD 379.00
In Stock
Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI8G7 (formerly 8G7)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI7G10 (formerly 7G10)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
USD 159.00
2 Days
Active filters
Target Symbol
- GPI