Antibodies

Jump to Filters
View as table Download
GPLD1 Rabbit Polyclonal Antibody
TA331258

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPLD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPLD1 antibody is: synthetic peptide directed towards the N-terminal region of Human GPLD1. Synthetic peptide located within the following region: GKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMA
GPLD1 Rabbit Polyclonal Antibody
TA366604

USD 380.00

4 Weeks

GPLD1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GPLD1
GPLD1 Rabbit Polyclonal Antibody
TA376713

USD 220.00

3 Weeks

GPLD1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-160 of human GPLD1 (NP_001494.2).
Modifications Unmodified