Germany
Japan
United Kingdom
China
GPNMB mouse monoclonal antibody, clone 3A5, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPNMB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPNMB Antibody: synthetic peptide directed towards the N terminal of human GPNMB. Synthetic peptide located within the following region: DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN |
Rabbit Polyclonal Anti-GPNMB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPNMB Antibody: synthetic peptide directed towards the N terminal of human GPNMB. Synthetic peptide located within the following region: KGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNE |
Rabbit Polyclonal Anti-GPNMB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPNMB Antibody: synthetic peptide directed towards the N terminal of human GPNMB. Synthetic peptide located within the following region: DGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSV |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody, clone OTI5C2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody, clone OTI7E3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody,clone OTI2E10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GPNMB mouse monoclonal antibody,clone OTI2H7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GPNMB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-260 of human GPNMB (NP_001005340.1). |
| Modifications | Unmodified |
GPNMB mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GPNMB mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GPNMB mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GPNMB mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI1G10 (formerly 1G10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GPNMB mouse monoclonal antibody, clone OTI1G10 (formerly 1G10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GPNMB mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GPNMB mouse monoclonal antibody, clone OTI8A10 (formerly 8A10)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI5C2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI5C2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GPNMB mouse monoclonal antibody, clone OTI5C2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GPNMB mouse monoclonal antibody, clone OTI5C2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GPNMB mouse monoclonal antibody, clone OTI2F9 (formerly 2F9)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI7E3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody, clone OTI7E3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GPNMB mouse monoclonal antibody, clone OTI7E3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GPNMB mouse monoclonal antibody, clone OTI7E3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GPNMB mouse monoclonal antibody,clone OTI2E10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody,clone OTI2E10, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GPNMB mouse monoclonal antibody,clone OTI2E10, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GPNMB mouse monoclonal antibody,clone OTI2E10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GPNMB mouse monoclonal antibody,clone OTI2H7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
GPNMB mouse monoclonal antibody,clone OTI2H7, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GPNMB mouse monoclonal antibody,clone OTI2H7, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GPNMB mouse monoclonal antibody,clone OTI2H7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- GPNMB