Antibodies

View as table Download

Rabbit polyclonal anti-GPR15 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR15.

Rabbit Polyclonal Anti-GPR15 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen BOB / GPR15 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human GPR15. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Elephant, Pig (100%); Marmoset, Hamster (95%); Panda, Bat, Dog, Bovine, Rabbit, Horse (89%).

Rabbit Polyclonal GPR15 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GPR15 antibody was raised against a peptide corresponding to amino acids near the amino terminus of human GPR15. The sequence differs from those of African green monkey and pig-tailed macaque BOB by one amino acid (2).

Rabbit Polyclonal Anti-GPR15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR15 antibody: synthetic peptide directed towards the N terminal of human GPR15. Synthetic peptide located within the following region: FIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCS

Rabbit Polyclonal Anti-GPR15 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPR15

GPR15 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPR15