Antibodies

View as table Download

GPR157 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPR157

Rabbit polyclonal anti-GPR157 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR157.

Rabbit Polyclonal Anti-GPR157 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR157 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR157. Synthetic peptide located within the following region: VRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST

GPR157 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPR157