Antibodies

Jump to Filters
View as table Download
GPR158 Rabbit Polyclonal Antibody
TA315667

USD 345.00

4 Weeks

Rabbit polyclonal anti-GPR158 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR158.
GPR158 Rabbit Polyclonal Antibody
TA331816

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPR158 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR158 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR158. Synthetic peptide located within the following region: LPPKAVASKTENENLNQIGHQEKKTSSSEENVRGSYNSSNNFQQPLTSRA
GPR158 Rabbit Polyclonal Antibody
TA384319

USD 380.00

4 Weeks

GPR158 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GPR158. AA range:1-50