Antibodies

View as table Download

Rabbit Polyclonal Anti-GPR161 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: SISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLE

GPR161 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPR161

Rabbit Polyclonal Anti-GPR161 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the N terminal of human GPR161. Synthetic peptide located within the following region: MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV

Rabbit Polyclonal Anti-GPR161 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG

GPR161 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Hamster, Human, Monkey
Immunogen GPR161 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human GPR161. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Hamster (100%); Panda, Dog, Horse, Rabbit (95%); Mouse, Elephant, Bat, Pig, Opossum, Turkey, Chicken (89%).

Rabbit Polyclonal anti-GPR161 antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the C terminal of human GPR161. Synthetic peptide located within the following region: INLFGEEALPGVLVTARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLA

GPR161 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPR161