Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPR18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR18 antibody: synthetic peptide directed towards the middle region of human GPR18. Synthetic peptide located within the following region: GVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLT |
Rabbit Polyclonal Anti-GPR18 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GPCRW / GPR18 antibody was raised against synthetic 14 amino acid peptide from 2nd cytoplasmic domain of human GPR18. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Hamster, Bovine, Horse, Rabbit, Pig (100%); Mouse, Rat, Elephant (93%); Bat (86%). |
Rabbit Polyclonal Anti-GPR18 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GPCRW / GPR18 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human GPR18. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat, Elephant, Horse, Rabbit, Pufferfish (100%); Mouse, Rat, Bovine, Pig, Opossum, Salmon, Zebrafish, Stickleback (94%); Chicken, Platypus, Lizard, Catfish (88%); Hamster, Turkey (81%). |
Rabbit Polyclonal Anti-GPR18 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GPCRW / GPR18 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human GPR18. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Hamster, Horse, Pig, Opossum (94%); Mouse, Rat, Bat (89%); Elephant, Rabbit (83%). |
GPR18 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GPR18. |
Active filters
Target Symbol
- GPR18