Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPR27 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GPR27 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human GPR27. Percent identity with other species by BLAST analysis: Human, Mouse, Rat, Elephant, Panda (100%); Opossum (89%). |
Rabbit Polyclonal Anti-GPR27 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR27 antibody: synthetic peptide directed towards the N terminal of human GPR27. Synthetic peptide located within the following region: MANASEPGGSGGGEAAALGLKLATLSLLLCVSLAGNVLFALLIVRERSLH |
Rabbit Polyclonal Anti-GPR27 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR27 antibody: synthetic peptide directed towards the middle region of human GPR27. Synthetic peptide located within the following region: LVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAV |
Rabbit Polyclonal Anti-GPR27 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR27 antibody: synthetic peptide directed towards the middle region of human GPR27. Synthetic peptide located within the following region: AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVV |
GPR27 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GPR27 |
Active filters
Target Symbol
- GPR27