Rabbit polyclonal anti-SPR1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SPR1. |
Rabbit polyclonal anti-SPR1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SPR1. |
Rabbit Polyclonal Anti-GPR68 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR68 antibody is: synthetic peptide directed towards the middle region of Human GPR68. Synthetic peptide located within the following region: SIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLL |
Rabbit polyclonal anti-M Gpr68 antibody (Center)
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This Mouse Gpr68 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-225 amino acids from the Central region of mouse Gpr68. |
Rabbit Polyclonal Anti-SPR1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPR1 Antibody: A synthesized peptide derived from human SPR1 |
Rabbit Polyclonal Anti-GPR68 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR68 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR68. Synthetic peptide located within the following region: GILRAVRRSHGTQKSRKDQIQRLVLSTVVIFLACFLPYHVLLLVRSVWEA |
Rabbit Polyclonal Anti-GPR68 Antibody (Cytoplasmic Domain)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GPR68 / OGR1 antibody was raised against synthetic 18 amino acid peptide from 2nd cytoplasmic domain of human GPR68. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Horse, Rabbit, Pig (100%); Dog, Bovine (94%); Chicken, Platypus (89%). |
GPR68 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 276-365 of human GPR68 (NP_003476.3). |
Modifications | Unmodified |