Antibodies

View as table Download

Rabbit polyclonal anti-SPR1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SPR1.

Rabbit Polyclonal Anti-GPR68 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR68 antibody is: synthetic peptide directed towards the middle region of Human GPR68. Synthetic peptide located within the following region: SIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLL

Rabbit polyclonal anti-M Gpr68 antibody (Center)

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen This Mouse Gpr68 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-225 amino acids from the Central region of mouse Gpr68.

Rabbit Polyclonal Anti-SPR1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SPR1 Antibody: A synthesized peptide derived from human SPR1

Rabbit Polyclonal Anti-GPR68 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR68 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR68. Synthetic peptide located within the following region: GILRAVRRSHGTQKSRKDQIQRLVLSTVVIFLACFLPYHVLLLVRSVWEA

Rabbit Polyclonal Anti-GPR68 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GPR68 / OGR1 antibody was raised against synthetic 18 amino acid peptide from 2nd cytoplasmic domain of human GPR68. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Horse, Rabbit, Pig (100%); Dog, Bovine (94%); Chicken, Platypus (89%).

GPR68 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 276-365 of human GPR68 (NP_003476.3).
Modifications Unmodified