Antibodies

View as table Download

Rabbit Polyclonal Anti-GPR85 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR85 antibody is: synthetic peptide directed towards the N-terminal region of Human GPR85. Synthetic peptide located within the following region: YFLLDLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCF

Rabbit Polyclonal Anti-GPR85 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Immunogen SREB / GPR85 antibody was raised against synthetic 18 amino acid peptide from 3rd cytoplasmic domain of human GPR85. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bat, Bovine, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Lizard, Xenopus (100%); Stickleback, Pufferfish, Zebrafish (94%).

Rabbit Polyclonal Anti-GPR85 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen SREB / GPR85 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human GPR85. Percent identity with other species by BLAST analysis: Human, Orangutan, Mouse, Rat, Turkey, Chicken, Lizard, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%).

GPR85 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human GPR85.