Germany
Japan
United Kingdom
China
GPR87 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 328-357 amino acids from the C-terminal region of Human GPR87 / GPR95 |
Antibodies
View as table Download
Rabbit Polyclonal anti-GPR87 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR87 antibody: synthetic peptide directed towards the N terminal of human GPR87. Synthetic peptide located within the following region: MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL |
Rabbit Polyclonal anti-GPR87 antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR87 antibody: synthetic peptide directed towards the middle region of human GPR87. Synthetic peptide located within the following region: NQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL |
Rabbit Polyclonal Anti-GPR87 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GPR87 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GPR87. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset (100%). |
GPR87 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human GPR87 (NP_076404.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GPR87