Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-GPRC5A antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPRC5A. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPCR5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPCR5A antibody: synthetic peptide directed towards the C terminal of human GPCR5A. Synthetic peptide located within the following region: SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY |
Rabbit Polyclonal Anti-GPRC5A Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GPRC5A / RAI3 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human GPRC5A / RAI3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Bat, Dog, Panda (94%); Marmoset, Bovine (88%); Hamster, Rabbit, Opossum (81%). |
GPRC5A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAI3 |
GPRC5A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 258-357 of human GPRC5A (NP_003970.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GPRC5A