Antibodies

View as table Download

Rabbit polyclonal GPRIN2 antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human GPRIN2.

Rabbit Polyclonal Anti-GPRIN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPRIN2 antibody is: synthetic peptide directed towards the N-terminal region of Human GPRIN2. Synthetic peptide located within the following region: LSQSSSSLLGEGREQRPELRKTASSTVWQAQLGEASTRPQAPEEEGNPPE

GPRIN2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GPRIN2