Antibodies

Jump to Filters
View as table Download
Glutathione Peroxidase 2 (GPX2) Rabbit Polyclonal Antibody
TA308741

USD 415.00

In Stock

Rabbit polyclonal antibody to Glutathione Peroxidase 2 (glutathione peroxidase 2 (gastrointestinal))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 54 of GPX2
Glutathione Peroxidase 2 (GPX2) Rabbit Polyclonal Antibody
TA346318

USD 475.00

5 Days

Rabbit Polyclonal Anti-GPX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX2 antibody: synthetic peptide directed towards the middle region of human GPX2. Synthetic peptide located within the following region: GGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLII
Glutathione Peroxidase 2 (GPX2) Goat Polyclonal Antibody
TA303039

USD 375.00

5 Days

Goat Polyclonal Antibody against GPX2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SLDGEKVDFN, from the internal region of the protein sequence according to NP_002074.2.
Glutathione Peroxidase 2 (GPX2) Rabbit Polyclonal Antibody
TA376759

USD 220.00

3 Weeks

GPX2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human GPX2 (NP_002074.2).