Rabbit Polyclonal Anti-GREM2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GREM2 antibody: synthetic peptide directed towards the N terminal of human GREM2. Synthetic peptide located within the following region: MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIK |
Rabbit polyclonal anti-Gremlin-2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed human Gremlin-2 |
GREM2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human GREM2 (NP_071914.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China