Antibodies

View as table Download

Grainyhead like protein 1 homolog (GRHL1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 293-322 amino acids from the Central region of Human GRHL1 / LBP32.

Rabbit Polyclonal Anti-GRHL1 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-GRHL1 antibody: synthetic peptide directed towards the N terminal of human GRHL1. Synthetic peptide located within the following region: GENRVQVLKNVPFNIVLPHGNQLGIDKRGHLTAPDTTVTVSIATMPTHSI

GRHL1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GRHL1