USD 450.00
2 Weeks
Grainyhead like protein 1 homolog (GRHL1) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 293-322 amino acids from the Central region of Human GRHL1 / LBP32. |
Rabbit Polyclonal Anti-GRHL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-GRHL1 antibody: synthetic peptide directed towards the N terminal of human GRHL1. Synthetic peptide located within the following region: GENRVQVLKNVPFNIVLPHGNQLGIDKRGHLTAPDTTVTVSIATMPTHSI |
GRHL1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GRHL1 |
Germany
Japan
United Kingdom
China