Antibodies

Jump to Filters
View as table Download
Grhl2 Rabbit Polyclonal Antibody
TA345412

USD 475.00

5 Days

Rabbit Polyclonal Anti-Grhl2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Grhl2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Grhl2. Synthetic peptide located within the following region: MPSDPPFNTRRAYTSEDEAWKSYLENPLTAATKAMMSINGDEDSAAALGL
GRHL2 Rabbit Polyclonal Antibody
TA355623

USD 360.00

5 Days

GRHL2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human GRHL2
GRHL2 Rabbit Polyclonal Antibody
TA356046

USD 390.00

5 Days

GRHL2 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GRHL2
GRHL2 Rabbit Polyclonal Antibody
TA376770

USD 220.00

3 Weeks

GRHL2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-250 of human GRHL2 (NP_079191.2).
Modifications Unmodified