Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-GRK5 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GRK5. |
Antibodies
View as table Download
Rabbit polyclonal GRK5 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GRK5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 559-590 amino acids from the C-terminal region of human GRK5. |
GRK5 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Orang-Utan |
| Immunogen | GRK5 antibody was raised against synthetic 15 amino acid peptide from internal region of human GRK5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon (100%); Marmoset, Mouse, Rat, Panda, Dog, Bat, Horse (93%); Elephant, Bovine, Pig (87%). |
GRK5 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Human |
| Immunogen | GRK5 antibody was raised against synthetic 12 amino acid peptide from near N-terminus of human GRK5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Dog, Bovine (100%); Mouse, Rat, Pig (92%); Opossum, Chicken (83%). |
GRK5 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Chicken, Horse, Human, Monkey, Mouse, Pig, Rat |
| Immunogen | GRK5 antibody was raised against synthetic 15 amino acid peptide from internal region of human GRK5. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Bat, Bovine, Panda, Horse, Pig, Opossum, Turkey, Chicken, Platypus (100%); Orangutan, Dog, Elephant, Xenopus (93%). |
Rabbit Polyclonal Anti-GRK5 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRK5 antibody: synthetic peptide directed towards the middle region of human GRK5. Synthetic peptide located within the following region: FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG |
Rabbit Polyclonal Anti-GRK5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRK5 antibody is: synthetic peptide directed towards the C-terminal region of Human GRK5. Synthetic peptide located within the following region: WGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKS |
GRK5 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 371-590 of human GRK5 (NP_005299.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GRK5