Rabbit anti-GRN Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRN |
Rabbit anti-GRN Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRN |
Goat Anti-Granulin / GRN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence QSKCLSKENATTD, from the internal region of the protein sequence according to NP_002078.1. |
Rabbit polyclonal GRN Antibody (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GRN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 563-591 amino acids from the C-terminal region of human GRN. |
Rabbit Polyclonal Anti-GRN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRN antibody is: synthetic peptide directed towards the middle region of Human GRN. Synthetic peptide located within the following region: CPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD |
Carrier-free (BSA/glycerol-free) GRN mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GRN mouse monoclonal antibody, clone OTI3H6
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GRN mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GRN mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GRN mouse monoclonal antibody,clone OTI2D1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GRN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GRN rabbit polyclonal antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GRN |
GRN rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GRN |
Granulin Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 281-336 of human Granulin (NP_002078.1). |
Modifications | Unmodified |
GRN mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GRN mouse monoclonal antibody, clone OTI4B9 (formerly 4B9), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
GRN mouse monoclonal antibody, clone OTI4B9 (formerly 4B9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
GRN mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GRN mouse monoclonal antibody, clone OTI3H6
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GRN mouse monoclonal antibody, clone OTI3H6, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
GRN mouse monoclonal antibody, clone OTI3H6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
GRN mouse monoclonal antibody, clone OTI3H6
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GRN mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GRN mouse monoclonal antibody, clone OTI3B3 (formerly 3B3), Biotinylated
Applications | IHC |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
GRN mouse monoclonal antibody, clone OTI3B3 (formerly 3B3), HRP conjugated
Applications | IHC |
Reactivities | Human |
Conjugation | HRP |
GRN mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GRN mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GRN mouse monoclonal antibody, clone OTI1F9 (formerly 1F9), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
GRN mouse monoclonal antibody, clone OTI1F9 (formerly 1F9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
GRN mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GRN mouse monoclonal antibody,clone OTI2D1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GRN mouse monoclonal antibody,clone OTI2D1, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
GRN mouse monoclonal antibody,clone OTI2D1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
GRN mouse monoclonal antibody,clone OTI2D1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GRN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GRN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
GRN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
GRN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".