Rabbit Polyclonal Anti-GRSF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRSF1 antibody: synthetic peptide directed towards the middle region of human GRSF1. Synthetic peptide located within the following region: IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV |
Rabbit Polyclonal Anti-GRSF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRSF1 antibody: synthetic peptide directed towards the N terminal of human GRSF1. Synthetic peptide located within the following region: SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYL |
GRSF1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GRSF1 |
GRSF1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRSF1. |
Germany
Japan
United Kingdom
China
