Antibodies

View as table Download

Rabbit Polyclonal Anti-GSTA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTA4 antibody: synthetic peptide directed towards the C terminal of human GSTA4. Synthetic peptide located within the following region: LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

Rabbit Polyclonal antibody to GSTA4 (glutathione S-transferase alpha 4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 222 of GSTA4 (Uniprot ID#O15217)

Carrier-free (BSA/glycerol-free) GSTA4 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GSTA4 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

GSTA4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

GSTA4 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse GSTA4

Anti-GSTA4 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)

Applications WB
Reactivities Human
Conjugation Unconjugated

GSTA4 mouse monoclonal antibody, clone 1E2, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

Anti-GSTA4 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)

Applications WB
Reactivities Human
Conjugation Unconjugated

GSTA4 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

GSTA4 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated