Rabbit Polyclonal Anti-GSTA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTA4 antibody: synthetic peptide directed towards the C terminal of human GSTA4. Synthetic peptide located within the following region: LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP |
Carrier-free (BSA/glycerol-free) GSTA4 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GSTA4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GSTA4 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse GSTA4 |
Anti-GSTA4 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GSTA4 mouse monoclonal antibody, clone 1E2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GSTA4 mouse monoclonal antibody, clone 1E2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Anti-GSTA4 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
