Antibodies

View as table Download

Rabbit Polyclonal Anti-GTF2B Antibody - C-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2B antibody: synthetic peptide directed towards the C terminal of human GTF2B. Synthetic peptide located within the following region: SVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFP

Rabbit Polyclonal Anti-GTF2B Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2B antibody: synthetic peptide directed towards the N terminal of human GTF2B. Synthetic peptide located within the following region: NLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFK

Rabbit Polyclonal Anti-GTF2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2B antibody: synthetic peptide directed towards the N terminal of human GTF2B. Synthetic peptide located within the following region: ECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIG

Mouse Monoclonal TFIIB Antibody

Applications WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2B mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2B mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2B mouse monoclonal antibody, clone OTI2A1 (formerly 2A1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2B mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2B mouse monoclonal antibody, clone OTI5B6 (formerly 5B6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Gtf2b Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated

GTF2B Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human GTF2B (NP_001505.1).
Modifications Unmodified

GTF2B mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2B mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2B mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2B mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2B mouse monoclonal antibody, clone OTI2A1 (formerly 2A1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2B mouse monoclonal antibody, clone OTI2A1 (formerly 2A1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2B mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2B mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2B mouse monoclonal antibody, clone OTI5B6 (formerly 5B6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2B mouse monoclonal antibody, clone OTI5B6 (formerly 5B6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated