Antibodies

View as table Download

Rabbit Polyclonal Anti-GTF2IRD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2IRD1 antibody: synthetic peptide directed towards the N terminal of human GTF2IRD1. Synthetic peptide located within the following region: MALLGKRCDVPTNGCGPDRWNSAFTRKDEIITSLVSALDSMCSALSKLNA

Rabbit Polyclonal Anti-GTF2IRD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2IRD1 antibody: synthetic peptide directed towards the C terminal of human GTF2IRD1. Synthetic peptide located within the following region: VIINQLQPFAEICNDAKVPAKDSSIPKRKRKRVSEGNSVSSSSSSSSSSS

Rabbit polyclonal anti-GTF2IRD1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human GTF2IRD1.

Rabbit Polyclonal Anti-GTF2IRD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2IRD1 antibody: synthetic peptide directed towards the C terminal of human GTF2IRD1. Synthetic peptide located within the following region: TFGSQNLERILAVADKIKFTVTRPFQGLIPKPDEDDANRLGEKVILREQV

Carrier-free (BSA/glycerol-free) GTF2IRD1 mouse monoclonal antibody,clone OTI9A3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2IRD1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 660-959 of human GTF2IRD1 (NP_057412.1).
Modifications Unmodified

GTF2IRD1 mouse monoclonal antibody,clone OTI9A3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2IRD1 mouse monoclonal antibody,clone OTI9A3, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GTF2IRD1 mouse monoclonal antibody,clone OTI9A3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated