Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-Gtpbp10 Antibody
| Reactivities | Rat |
| Immunogen | The immunogen for Anti-Gtpbp10 antibody is: synthetic peptide directed towards the N-terminal region of Rat Gtpbp10. Synthetic peptide located within the following region: MVRCGCALLRKYGNFIDNLRIFTKGGSGGMGYPRLGGEGGRGGDVWVVAH |
Rabbit Polyclonal Anti-GTPBP10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GTPBP10 |
GTPBP10 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GTPBP10 |
GTPBP10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-387 of human GTPBP10 (NP_149098.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GTPBP10