Rabbit Polyclonal Anti-GTPBP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTPBP2 antibody: synthetic peptide directed towards the N terminal of human GTPBP2. Synthetic peptide located within the following region: GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEH |
Rabbit Polyclonal Anti-GTPBP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTPBP2 antibody: synthetic peptide directed towards the C terminal of human GTPBP2. Synthetic peptide located within the following region: VLLFHATTFRRGFQVTVHVGNVRQTAVVEKIHAKDKLRTGEKAVVRFRFL |
Rabbit polyclonal anti-GTPBP2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GTPBP2. |
GTPBP2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GTPBP2 |
GTPBP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human GTPBP2 (NP_061969.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
