Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 16 of 16 results

(reset)

Guanylate kinase (GUK1) Rabbit Polyclonal Antibody

TA336215

USD 375.00

5 Days

Rabbit Polyclonal Anti-GUK1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-GUK1 Antibody: synthetic peptide directed towards the middle region of human GUK1. Synthetic peptide located within the following region: IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI

Guanylate kinase (GUK1) Rabbit Polyclonal Antibody

TA336961

USD 402.00

5 Days

Rabbit Polyclonal Guanylate kinase Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Within the range of amino acids 128-166 of human GUK1 protein were used as the immunogen.

1 / 2

2 / 2

Previous Next

Guanylate kinase (GUK1) Mouse Monoclonal Antibody [Clone ID: OTI1D7]

CF502659

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GUK1 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Guanylate kinase (GUK1) Mouse Monoclonal Antibody [Clone ID: OTI4A8]

CF502692

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GUK1 mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Guanylate kinase (GUK1) Rabbit Polyclonal Antibody

TA351238

USD 345.00

In Stock

Rabbit Polyclonal Anti-GUK1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human GUK1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Guk1 Rabbit Polyclonal Antibody

TA357160

USD 360.00

5 Days

Guk1 Antibody - N-terminal region

Applications	WB
Reactivities	Rat
Conjugation	Unconjugated

GUK1 Rabbit Polyclonal Antibody

TA367074

USD 380.00

4 Weeks

GUK1 rabbit polyclonal antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human GUK1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Guanylate kinase (GUK1) Rabbit Polyclonal Antibody

TA376883

USD 220.00

3 Weeks

GUK1 Rabbit polyclonal Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human GUK1 (NP_000849.1).
Modifications	Unmodified

Guanylate kinase (GUK1) Mouse Monoclonal Antibody [Clone ID: OTI1D7]

TA502659

USD 379.00

In Stock

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Guanylate kinase (GUK1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D7]

TA502659AM

USD 420.00

4 Weeks

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Guanylate kinase (GUK1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D7]

TA502659BM

USD 420.00

4 Weeks

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Guanylate kinase (GUK1) Mouse Monoclonal Antibody [Clone ID: OTI1D7]

TA502659S

USD 159.00

2 Days

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Guanylate kinase (GUK1) Mouse Monoclonal Antibody [Clone ID: OTI4A8]

TA502692

USD 379.00

In Stock

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Guanylate kinase (GUK1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A8]

TA502692AM

USD 420.00

4 Weeks

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI4A8 (formerly 4A8), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Guanylate kinase (GUK1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A8]

TA502692BM

USD 420.00

4 Weeks

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI4A8 (formerly 4A8), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Guanylate kinase (GUK1) Mouse Monoclonal Antibody [Clone ID: OTI4A8]

TA502692S

USD 159.00

2 Days

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 16 of 16 results