Rabbit Polyclonal Anti-GYS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GYS2 antibody: synthetic peptide directed towards the middle region of human GYS2. Synthetic peptide located within the following region: TLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVED |
Rabbit Polyclonal Anti-GYS2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GYS2 |
GYS2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GYS2 |
GYS2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 594-703 of human GYS2 (NP_068776.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China