Antibodies

View as table Download

Rabbit Polyclonal Anti-GZMA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GZMA antibody: synthetic peptide directed towards the middle region of human GZMA. Synthetic peptide located within the following region: TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNS

Rabbit Polyclonal Anti-GZMA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GZMA antibody: synthetic peptide directed towards the C terminal of human GZMA. Synthetic peptide located within the following region: LRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKH

GZMA Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-262 of human GZMA (NP_006135.1).
Modifications Unmodified