Rabbit Polyclonal Anti-GZMA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GZMA antibody: synthetic peptide directed towards the middle region of human GZMA. Synthetic peptide located within the following region: TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNS |
Rabbit Polyclonal Anti-GZMA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GZMA antibody: synthetic peptide directed towards the C terminal of human GZMA. Synthetic peptide located within the following region: LRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKH |
GZMA Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 29-262 of human GZMA (NP_006135.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China