Antibodies

View as table Download

Rabbit Polyclonal Anti-GABARAPL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GABARAPL1 Antibody: synthetic peptide directed towards the middle region of human GABARAPL1. Synthetic peptide located within the following region: KAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTI

Rabbit Polyclonal Anti-GABARAPL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GABARAPL1 Antibody: synthetic peptide directed towards the N terminal of human GABARAPL1. Synthetic peptide located within the following region: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL

GABARAPL1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human GABARAPL1

GABARAPL1 Antibody - N-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse GABARAPL1

GABARAPL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human GABARAPL1 (NP_113600.1).
Modifications Unmodified