Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GABPB2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the N terminal of human GABPB2. Synthetic peptide located within the following region: MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGH |
Rabbit Polyclonal antibody to GABPB1 (GA binding protein transcription factor, beta subunit 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 395 of GABPB1 (Uniprot ID#Q06547) |
Rabbit Polyclonal Anti-GABPB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the C terminal of human GABPB2. Synthetic peptide located within the following region: PDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQ |
Rabbit Polyclonal anti-GABPB2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the middle region of human GABPB2. Synthetic peptide located within the following region: EPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKKEQ |
Rabbit Polyclonal Anti-GABPB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the C terminal of human GABPB2. Synthetic peptide located within the following region: EEREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEA |
Rabbit Polyclonal Anti-GABPB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the C terminal of human GABPB2. Synthetic peptide located within the following region: PDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQ |
Carrier-free (BSA/glycerol-free) GABPB1 mouse monoclonal antibody,clone OTI3F1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GABPB1 mouse monoclonal antibody,clone OTI4D7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GABPB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GABPB2 |
GABPB1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GABPB1 |
GABPB1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GABPB1 |
GABPB1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 231-395 of human GABPB1 (NP_005245.2). |
| Modifications | Unmodified |
GABPB1 mouse monoclonal antibody,clone OTI3F1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GABPB1 mouse monoclonal antibody,clone OTI3F1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
GABPB1 mouse monoclonal antibody,clone OTI3F1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
GABPB1 mouse monoclonal antibody,clone OTI3F1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
GABPB1 mouse monoclonal antibody,clone OTI4D7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GABPB1 mouse monoclonal antibody,clone OTI4D7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
GABPB1 mouse monoclonal antibody,clone OTI4D7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
GABPB1 mouse monoclonal antibody,clone OTI4D7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- GABPB1